PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000260803
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 485aa    MW: 53331.1 Da    PI: 7.1418
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000260803genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.55.7e-28112170160
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    ldDgy+WrKYGqK+vkg+ + rsYYrCt+++C+vk++ver++  +++++++Y geH+h+k
  MDP0000260803 112 LDDGYHWRKYGQKSVKGNXYVRSYYRCTHPKCEVKRQVERKH-SGQITDTIYFGEHEHSK 170
                    59***************************************9.***************85 PP

2WRKY103.21.5e-32288345259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vkg+++prsYYrC+ +gCpv+k+ver+++d kvv+ tYeg+H+h+
  MDP0000260803 288 SDGYRWRKYGQKLVKGNPNPRSYYRCSNPGCPVRKHVERASHDSKVVIATYEGQHDHD 345
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-25105171IPR003657WRKY domain
PROSITE profilePS5081120.954107171IPR003657WRKY domain
SuperFamilySSF1182902.09E-22110169IPR003657WRKY domain
SMARTSM007741.8E-30112170IPR003657WRKY domain
PfamPF031064.6E-22113168IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-34276347IPR003657WRKY domain
SuperFamilySSF1182907.06E-29279347IPR003657WRKY domain
PROSITE profilePS5081135.921282347IPR003657WRKY domain
SMARTSM007741.5E-37287346IPR003657WRKY domain
PfamPF031069.8E-26289344IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MISRGEDGTD KVASDVLQKK ESSDSEINVP HQTPNKGIYP LQSDHKGTAQ FLTPEKASQV  60
PDGVVSASQP NQEGSASSLT SEKTPQTPET TALALRSGQE GTTPSTTLER VLDDGYHWRK  120
YGQKSVKGNX YVRSYYRCTH PKCEVKRQVE RKHSGQITDT IYFGEHEHSK VQSVPAAVSF  180
VVSIVDDGRP EVVLETDGED KSSNAHGHAS NQIEPVDPPQ LSSVAVTEAV QGVLAQSNRT  240
RDGDPDPKRQ YVLAIAILNF PVHWKKAKHK GNSLPVVVQT LSEVDIVSDG YRWRKYGQKL  300
VKGNPNPRSY YRCSNPGCPV RKHVERASHD SKVVIATYEG QHDHDMPPTR TVTHNTAASN  360
VFTTARISES GAVPKGNAVC RDTSPEHEVK PSKQRKTKSR DVAGSDVVVD SDLSPERTLH  420
EKLVAKACTT KESEPPYMIV CRADQMKTLE LGIKSEGDDM VVCDNLRPES NPLEQEKPKA  480
EPVDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-35107348375WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.270960.0fruit| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2297563e-47KP229756.1 UNVERIFIED: Boehmeria nivea WRKY transcription factor-like (WRKY27) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342183.10.0PREDICTED: WRKY transcription factor 1-like
TrEMBLM5X4P50.0M5X4P5_PRUPE; Uncharacterized protein
STRINGVIT_12s0057g00550.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93583343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.24e-81zinc-dependent activator protein-1